PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G182701.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 272aa    MW: 28674.3 Da    PI: 6.1107
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G182701.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26046.41.1e-1426043101
                DUF260  43 lkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                           lk+lk++ ++  ++am++++y+++ara dPv G+vg+i++lq+q++ +++el+ +++++
  Sobic.002G182701.1.p   2 LKTLKRVGPKYGPEAMRTIIYQSDARAADPVGGCVGIINQLQRQIRDADVELQFVRQQI 60 
                           688999999999*******************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.675160IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-12257IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MLKTLKRVGP KYGPEAMRTI IYQSDARAAD PVGGCVGIIN QLQRQIRDAD VELQFVRQQI  60
AICRQHQQAA AGVLSGPAAA MILPHADASS PVVGVGLVAA GQQDHKVAVD AMIYTAGRGQ  120
QPSIPAGDDP SSHQQQLYDY FCYNNGTAGD EATSDDGGMQ QYGGLADVVG GSVAKAGSRA  180
VALGEQLGQH CQIQIQALPF VDAFNEKKPQ ILPATIQHHG RAAAGDLLHP GKKKLVTPKV  240
LVEHDDVDEH MDEQQATAGA PCHLELGFSS F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460124.11e-164hypothetical protein SORBIDRAFT_02g023070
TrEMBLC5XB911e-164C5XB91_SORBI; Putative uncharacterized protein Sb02g023070
STRINGSb02g023070.11e-163(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-13LOB domain-containing protein 22